intros & kits

(225 Items)
  • 158168 BOKNFPRRMT BOKNFPRRMT 1 Replenishing Moisture Duo with Free Masque 3 pc. bōkka BOTÁNIKA bōkka BOTÁNIKA Replenishing Moisture Duo with Free Masque 3 pc. False bkkabotnika/ja24bokkareplenishingpromo.jpg Bonus Deal Available 38.00 38.00 30.00 True True Valid Thru 02/28/25 False False 30.00 False False Diversion contract required. 0 bōkka BOTÁNIKA Replenishing Moisture Duo with Free Masque includes shampoo, conditioner, and mask.
    Purchase 1 Each:
    replenishing moisture SHAMPOO 10.1 oz.
    replenishing moisture CONDITIONER 10.1 oz.
    Receive 1 FREE:
    replenishing moisture MASQUE 8 oz.
    False Log in to view pricing! False
    bōkka BOTÁNIKA Replenishing Moisture Duo with Free Masque 3 pc.

    bōkka BOTÁNIKA
    Replenishing Moisture Duo with Free Masque

    3 pc.

    SKU BOKNFPRRMT

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 40147 CEZNFLMRB-CL CEZNFLMRB-CL 1 Aftercare Retail Bag w/ Tissue Cezanne Cezanne Aftercare Retail Bag w/ Tissue False cezanne/cezanneretailbagcontent.jpeg Bonus Deal Available 4.00 4.00 1.00 True True False False 1.00 False False Diversion contract required. 0 Cezanne Aftercare Retail Logo Bag with Tissue Paper. True Log in to view pricing! False
    Cezanne Aftercare Retail Bag w/ Tissue

    Cezanne
    Aftercare Retail Bag w/ Tissue

    SKU CEZNFLMRB-CL

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 67843 DAVNFACITSK3* DAVNFACITSK3* 1 Reflection Collection Stencil Kit 2 pc. Davines Davines Imprinter Reflection Collection Stencil Kit 2 pc. False davines/davinesreflectionstencilkit.jpg Bonus Deal Available 135.00 135.00 60.00 True True False False 60.00 False True Diversion contract required. 0 Davines Imprinter Reflection Collection Stencil Kit includes new stencils to create fun new looks. The Imprinter opens new creative horizons for colorists, giving the possibility to create unique artistic results. With a simple action it is now possible to create permanent chromatic effects that were impossible to achieve freehand. True Log in to view pricing! False
    Davines Reflection Collection Stencil Kit 2 pc.

    Davines
    Imprinter Reflection Collection Stencil Kit

    2 pc.

    SKU DAVNFACITSK3*

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 51213 DAVNFACITSK* DAVNFACITSK* 1 Stencils - 1st Edition 2 pc. Davines Davines Imprinter Stencils - 1st Edition 2 pc. False davines/davinesimprinterstencilsonly.jpg Bonus Deal Available 135.00 135.00 60.00 True True False False 60.00 False True Diversion contract required. 0 Davines Imprinter Stencils - 1st Edition. The Imprinter opens new creative horizons for colorists, giving the possibility to create unique artistic results. With a simple action it is now possible to create permanent chromatic effects that were impossible to achieve freehand. True Log in to view pricing! False
    Davines Stencils - 1st Edition 2 pc.

    Davines
    Imprinter Stencils - 1st Edition

    2 pc.

    SKU DAVNFACITSK*

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 56995 DAVNFACITSK2* DAVNFACITSK2* 1 Stencils - 2nd Edition 2 pc. Davines Davines Imprinter Stencils - 2nd Edition 2 pc. False davines/davinesimprinterstarscollection.jpg Bonus Deal Available 135.00 135.00 60.00 True True False False 60.00 False True Diversion contract required. 0 Davines Imprinter Stencils - 2nd Edition. The Imprinter opens new creative horizons for colorists, giving the possibility to create unique artistic results. With a simple action it is now possible to create permanent chromatic effects that were impossible to achieve freehand. True Log in to view pricing! False
    Davines Stencils - 2nd Edition 2 pc.

    Davines
    Imprinter Stencils - 2nd Edition

    2 pc.

    SKU DAVNFACITSK2*

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 78579 DAVNFACITSK4* DAVNFACITSK4* 1 Wild. Stencil Kit 4 pc. Davines Davines Imprinter Wild. Stencil Kit 4 pc. False davines/davinesimprinterwildstencilkit.jpg Bonus Deal Available 135.00 135.00 60.00 True True False False 60.00 False True Diversion contract required. 0 Davines Imprinter Wild Stencil Kit is inspired by the uncontaminated wonders of nature, dense with beauty, light and an indescribable energetic support, Angelo Seminara’s Imprinter Wild stencil kit provides the tools to create any desired transformation, from the natural to the most dramatic and self-expressive. True Log in to view pricing! False
    Davines Wild. Stencil Kit 4 pc.

    Davines
    Imprinter Wild. Stencil Kit

    4 pc.

    SKU DAVNFACITSK4*

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 164688 DAVESPRLSDK2025 DAVESPRLSDK2025 1 LOVE/ smoothing Kit 5 pc. Davines Davines LOVE/ smoothing Kit 5 pc. False davines/davineslovesmoothkit5pc.jpg Bonus Deal Available 24.00 24.00 20.50 True True Valid Thru 02/28/25 False False 20.50 False True Diversion contract required. 0 Davines Love/ smoothing Kit includes shampoo, conditioner, mask, pochette, and hangtag.
    Includes:
    1 LOVE/ smoothing shampoo 2.5 oz.
    1 LOVE/ smoothing conditioner 2.5 oz.
    1 LOVE/ smoothing instant mask 2.67 oz.
    1 LOVE/smoothing travel pochette
    1 LOVE/smoothing hangtag
    True Log in to view pricing! False
    Davines LOVE/ smoothing Kit 5 pc.

    Davines
    LOVE/ smoothing Kit

    5 pc.

    SKU DAVESPRLSDK2025

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 154667 DAVNFAOWSBK DAVNFAOWSBK 1 WE STAND/ Travel Kit 4 pc. Davines Davines WE STAND/ Travel Kit 4 pc. False noimage.png Bonus Deal Available 35.00 35.00 21.00 True True False False 21.00 False True Diversion contract required. 0 Davines WE STAND/ Travel Kit includes bar, conditioner, comb, and travel cube.
    Includes 1 Each:
    WE STAND/for regeneration hair & body wash bar
    MOMO/ conditioner 2.5 oz.
    Circularity Comb
    Regenerative Organic Travel Cube
    True Log in to view pricing! False

    Davines
    WE STAND/ Travel Kit

    4 pc.

    SKU DAVNFAOWSBK

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 166347 EVOEVPRPB25 EVOEVPRPB25 1 mother's day planter box 14 pc. evo evo mother's day planter box 14 pc. False noimage.png Bonus Deal Available 233.34 233.34 155.50 True True False False 155.50 False False Diversion contract required. 0 evo mother's day planter box includes mask, treatment, balm, powder, spray, dry shampoo, mousse, paste, and planter box. True Log in to view pricing! False

    evo
    mother's day planter box

    14 pc.

    SKU EVOEVPRPB25

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 93195 EVOEVPPGC EVOEVPPGC 1 the grooms crew box 6 pc. evo evo the grooms crew box 6 pc. False evo/ma20evothegroomscrewbox.jpg Bonus Deal Available 20.00 20.00 15.00 True True True False 15.00 False False Diversion contract required. 0 evo the grooms crew box contains shampoo, conditioner, shaving cream, body wash, face balm and texture paste. True Log in to view pricing! False
    evo the grooms crew box 6 pc.

    evo
    the grooms crew box

    6 pc.

    SKU EVOEVPPGC

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 94751 EVOEVPPTF EVOEVPPTF 1 twist of fate travel box 5 pc. evo evo twist of fate travel box 5 pc. False evo/evocurltravelproductbox.jpg Bonus Deal Available 17.00 17.00 12.75 True True True False 12.75 False False Diversion contract required. 0 treat your curls to a glimpse of their destiny; a future of twisted glory with evo fabuloso twist of fate travel box. True Log in to view pricing! False
    evo twist of fate travel box 5 pc.

    evo
    twist of fate travel box

    5 pc.

    SKU EVOEVPPTF

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 166348 EVOEVPRWL-H EVOEVPRWL-H 1 wonderlocks - hydrate 4 pc. evo evo wonderlocks - hydrate 4 pc. False noimage.png Bonus Deal Available 61.80 61.80 42.60 True True False False 42.60 False False Diversion contract required. 0 evo wonderlocks - hydrate includes shampoo, conditioner, mask, and cosmetic bag.
    Includes:
    1 the therapist hydrating shampoo 10.1 oz.
    1 the therapist hydrating conditioner 10.1 oz.
    1 the great hydrator moisture mask 5.1 oz.
    1 cosmetic bag
    True Log in to view pricing! False

    evo
    wonderlocks - hydrate

    4 pc.

    SKU EVOEVPRWL-H

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 166349 EVOEVPRWL-R EVOEVPRWL-R 1 wonderlocks - repair 4 pc. evo evo wonderlocks - repair 4 pc. False noimage.png Bonus Deal Available 61.80 61.80 42.60 True True False False 42.60 False False Diversion contract required. 0 evo wonderlocks - repair includes shampoo, conditioner, treatment, and cosmetic bag.
    Includes:
    1 ritual salvation repairing shampoo 10.1 oz.
    1 ritual salvation repairing conditioner 10.1 oz.
    1 mane attention protein treatment 4.7 oz.
    1 cosmetic bag
    True Log in to view pricing! False

    evo
    wonderlocks - repair

    4 pc.

    SKU EVOEVPRWL-R

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 166350 EVOEVPRWL-V EVOEVPRWL-V 1 wonderlocks - volume 4 pc. evo evo wonderlocks - volume 4 pc. False noimage.png Bonus Deal Available 60.40 60.40 41.90 True True False False 41.90 False False Diversion contract required. 0 evo wonderlocks - volume includes shampoo, conditioner, spray, and cosmetic bag.
    Includes:
    1 gluttony volumising shampoo 10.1 oz.
    1 bride of gluttony volume conditioner 10.1 oz.
    1 root canal volumising spray 6.8 oz.
    1 cosmetic bag
    True Log in to view pricing! False

    evo
    wonderlocks - volume

    4 pc.

    SKU EVOEVPRWL-V

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 155132 FRANFACCK-BAE FRANFACCK-BAE 1 Baecation Kit 9 pc. Framar Framar Baecation Kit 9 pc. False framar/framarbaecationkit.jpg Bonus Deal Available 27.99 27.99 15.99 True True False False 15.99 False False Diversion contract required. 0 Framar Baecation Kit includes bowl, brush, gator grip, and foil.
    Includes:
    3 Connect & Color Bowls
    3 Wheat Fibre Color Brushes
    2 Gator Grips
    1 Pop Up Foil 50 ct.
    True Log in to view pricing! False
    Framar Baecation Kit 9 pc.

    Framar
    Baecation Kit

    9 pc.

    SKU FRANFACCK-BAE

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
(225 Items)